PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc09340.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family B3
Protein Properties Length: 219aa    MW: 25147.2 Da    PI: 8.1984
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc09340.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B331.62.9e-10841332980
                                   -..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                            B3  29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                                   +k +++tl+ e es rsW+v      +    +l+ GWk F+++n+LkegD +
  Zmw_sc09340.1.g00010.1.sm.mk  84 EKSCTITLKTEMESIRSWKVHG--LAYEHVNYLGHGWKIFCQDNRLKEGDGF 133
                                   455666666666777*******..9999999*******************66 PP

2B350.53.7e-161362092599
                                   TT---..--SEEEEEE..TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                            B3  25 ehggkkeesktltled..esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                                   ++g++ ++  t+tl++   s +sW+v ++ + k+g+y l++ W +F+++n+LkegD+++Fk+++  +  l++k f++
  Zmw_sc09340.1.g00010.1.sm.mk 136 AIGLQGPC--TITLKTsiHSAKSWQVDVS-KEKKGSYQLGQDWCKFCQDNRLKEGDICTFKYMSAACSVLTIKTFDA 209
                                   55666445..55555532667*******4.666678***************************99888899999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.5E-73780IPR015300DNA-binding pseudobarrel domain
CDDcd100171.41E-737131No hitNo description
SuperFamilySSF1019363.92E-782133IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.2E-884133IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.00688131IPR003340B3 DNA binding domain
SMARTSM010199.2E-4117210IPR003340B3 DNA binding domain
SuperFamilySSF1019362.75E-13133212IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.4E-14134212IPR015300DNA-binding pseudobarrel domain
CDDcd100175.86E-12137208No hitNo description
PfamPF023624.4E-14138209IPR003340B3 DNA binding domain
PROSITE profilePS5086311.011144210IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MPLLFTDTQL YNTFAISQLI KPAMIDMQDA SWKYLRMIPA KFVKHYVTDE YMNCQMAAVI  60
LDPLGKFWRF KVEKDRSGIC IGFEKSCTIT LKTEMESIRS WKVHGLAYEH VNYLGHGWKI  120
FCQDNRLKEG DGFFIAIGLQ GPCTITLKTS IHSAKSWQVD VSKEKKGSYQ LGQDWCKFCQ  180
DNRLKEGDIC TFKYMSAACS VLTIKTFDAS CCFTELVTN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187